missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NHP2L1 (aa 2-126) Control Fragment Recombinant Protein

Product Code. 30195035
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195035

Brand: Invitrogen™ RP91397

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83073 (PA5-83073. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P55769
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4809
Name Human NHP2L1 (aa 2-126) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias [U4/U6.U5] tri-snRNP 15.5 kD RNA binding protein; 15.5 K; CTA-216E10.8; FA1; FA-1; Fertilization antigen 1; fertilization antigen-1; Fta1; high mobility group-like nuclear protein 2 homolog 1; hSNU13; NHP2 non-histone chromosome protein 2-like 1; NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae); NHP2L1; NHP2-like protein 1; NHP2-like protein 1, N-terminally processed; NHPX; non-histone chromosome protein 2-like 1; Otk27; small nuclear ribonucleoprotein 15.5 kDa (U4/U6.U5); SNRNP15-5; SNU13; SNU13 homolog; SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5); SPAG12; sperm specific antigen 1; sperm-specific antigen 1; Ssfa1; U4/U6.U5 small nuclear ribonucleoprotein SNU13; U4/U6.U5 tri-snRNP 15.5 kDa protein; U4/U6.U5] tri-snRNP 15.5 kDa protein
Common Name NHP2L1
Gene Symbol SNU13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.