missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209496

Invitrogen™ Human NUDT9 (aa 190-262) Control Fragment Recombinant Protein

Product Code. 30209496
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209496 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209496 Supplier Invitrogen™ Supplier No. RP103725

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60851 (PA5-60851. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

YBX1 binds to splice sites in pre-mRNA and regulates splice site selection. This protein binds and stabilizes cytoplasmic mRNA and contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors. It binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as HLA class II genes. It regulates the transcription of numerous genes and promotes separation of DNA strands that contain mismatches or are modified by cisplatin. It has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro), and it may play a role in DNA repair.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BW91
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 53343
Name Human NUDT9 (aa 190-262) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1190002C07Rik; Adenosine diphosphoribose pyrophosphatase; ADP-ribose diphosphatase; ADP-ribose phosphohydrolase; ADP-ribose pyrophosphatase; ADP-ribose pyrophosphatase, mitochondrial; ADP-ribose pyrosphosphatase NUDT9; ADPR-PPase; AI462474; fu33g07; hypothetical protein LOC406661; mitochondrial ADP-ribose pyrophosphatase-like protein; nucleoside diphosphate linked moiety X-type motif 9; nucleoside diphosphate-linked moiety x motif 9; nudix (nucleoside diphosphate linked moiety X)-type motif 9; nudix hydrolase 9; nudix motif 9; nudix -type motif 9; nudix-type motif 9; NUDT10; Nudt9; PSEC0099; sb:cb392; UNQ3012/PRO9771; wu:fj16b09; wu:fu33g07; zgc:63924
Common Name NUDT9
Gene Symbol Nudt9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.