missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200832

Invitrogen™ Human Oxytocin (aa 57-94) Control Fragment Recombinant Protein

Product Code. 30200832
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30200832 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30200832 Supplier Invitrogen™ Supplier No. RP108592

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111683 (PA5-111683. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

There are two proteins encoded by this gene, oxytocin and neurophysin I. Oxytocin is posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P01178
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5020
Name Human Oxytocin (aa 57-94) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias neurophysin 1; neurophysin I; Ocytocin; Ot; OT-NPI; oxcytocin; OXT; OXT-NPI; Oxy; Oxytocin; oxytocin, prepro- (neurophysin I); oxytocin, prepropeptide; oxytocin/neurophysin (Oxt) gene, complete gene, complete cds; oxytocin/neurophysin 1 prepropeptide; oxytocin/neurophysin I prepropeptide; oxytocin-neurophysin 1; oxytocin-neurophysin I; oxytocin-neurophysin I, preproprotein; prepropeptide for oxytocin and neurophysin; unnamed protein product
Common Name Oxytocin
Gene Symbol OXT
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.