missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210559

Invitrogen™ Human p19 INK4d (aa 86-138) Control Fragment Recombinant Protein

Product Code. 30210559
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210559

Brand: Invitrogen™ RP106046

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83665 (PA5-83665. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

p19 is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P55273
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1032
Name Human p19 INK4d (aa 86-138) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CDK inhibitor p19INK4d; CDK4I; CDKN2D; cell cycle inhibitor, Nur77 associating protein; cyclin dependent kinase inhibitor 2 D; cyclin-dependent kinase 4 inhibitor D; cyclin-dependent kinase 4 inhibitor D p19; cyclin-dependent kinase inhibitor 2 D (p19, inhibits CDK4); inhibitor of cyclin-dependent kinase 4 d; INK4d; MTS1; p16-INK4; p16-INK4a; p19; p19INK4d; p19-INK4D; similar to cyclin-dependent kinase inhibitor 2 D
Common Name p19 INK4d
Gene Symbol CDKN2D
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.