missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209014

Invitrogen™ Human PACS1 (aa 674-724) Control Fragment Recombinant Protein

Product Code. 30209014
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209014

Brand: Invitrogen™ RP110188

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145087 (PA5-145087. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PACS-1 (CRA_a) is a 963 amino acid rich regulatory protein involved in protein trafficking and belongs to the PACS family. A coat protein involved in controlling the correct subcellular localization of trans-Golgi network (TGN) membrane proteins that contain acidic cluster sorting motifs, PACS-1 is also known to be involved in HIV-1 Nef-mediated removal of MHC-I from the cell surface to the TGN, thus enabling HIV-1 to escape immune surveillance. PACS-1 also controls the endosome to Golgi trafficking of furin and mannose-6-phosphate receptor by connecting the acidic-cluster-containing cytoplasmic domain of these molecules with the adapter-protein complex-1 (AP-1) of endosomal clathrin coated membrane pits. Usually seen in golgi apparatus, trans-Golgi network and localized in the paranuclear region, it is ubiquitously expressed in most of the tissues.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6VY07
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55690
Name Human PACS1 (aa 674-724) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI325977; cytosolic sorting protein PACS-1; KIAA1175; LOW QUALITY PROTEIN: phosphofurin acidic cluster sorting protein 1; phosphofurin acidic cluster sorting protein 1; MRD17; PACS1; PACS-1; Phosphofurin acidic cluster sorting protein 1
Common Name PACS1
Gene Symbol PACS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSVDSKYSSSFLDSGWRDLFSRSEPPVSEQLDVAGRVMQYVNGAATTHQLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.