missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209903

Invitrogen™ Human PGRMC2 (aa 174-223) Control Fragment Recombinant Protein

Product Code. 30209903
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209903

Brand: Invitrogen™ RP103756

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63599 (PA5-63599. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PGRMC2 (progesterone receptor membrane component 2), also known as DG6 (steroid receptor protein DG6) or PMBP (progesterone membrane-binding protein), is a single pass membrane protein belonging to the cytochrome b5 family (MAPR (membrane associated progesterone receptor) subfamily). Expressed in sperm, PGRMC2 is believed to function as a steroid receptor and may participate in the progesterone-dependent sperm acrosome reaction. PGRMC2 shares approximately 50% overall sequence identity with its close relative PGRMC1. The loss of the gene encoding PGRMC2 is associated with metastasis in uterine endocervical adenocarcinomas, implicating a potential role of PGRMC2 in the suppression of metastasis of endocervical adenocarcinomas.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15173
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10424
Name Human PGRMC2 (aa 174-223) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4631434O19Rik; 5730409G06Rik; DG6; Membrane-associated progesterone receptor component 2; Pgrmc2; PMBP; progesterone membrane binding protein; Progesterone membrane-binding protein; progesterone receptor membrane component 2; steroid receptor protein DG6
Common Name PGRMC2
Gene Symbol Pgrmc2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.