missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PHIP (aa 1518-1605) Control Fragment Recombinant Protein

Product Code. 30200984
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30200984 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30200984 Supplier Invitrogen™ Supplier No. RP92476

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54093 (PA5-54093. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PHIP (pleckstrin homology domain interacting protein), also known as ndrp or WDR11, is a 1,821 amino acid protein that contains eight N-terminal WD40 repeats and two bromodomains. It is expressed in skeletal muscle (localizing to the cytosol and nucleus) and primary beta cells (localizing to the nucleus) and acts as a transcriptional activator. PHIP is known to interact with various members of the insulin receptor substrate (IRS) family. The IRS family of proteins mediate insulin receptor signaling and play an important role in insulin-producing beta cell proliferation and survival. PHIP specifically associates with the PH domain of IRS-1 and may function to link IRS-1 to insulin receptors, indicating a vital role of PHIP in the regulation of insulin signaling.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WWQ0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55023
Name Human PHIP (aa 1518-1605) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810004D21Rik; 4632404O06Rik; BRWD2; DCAF14; DDB1 and CUL4 associated factor 14; DDB1- and CUL4-associated factor 14; FLJ20705; IRS-1 PH domain-binding protein; Ndrp; neuronal differentiation related protein; neuronal differentiation-related protein; PH-interacting protein; PHIP; pleckstrin homology domain interacting protein; WD repeat domain 11; WD repeat-containing protein 11; WDR11
Common Name PHIP
Gene Symbol PHIP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TEQPSTSSAAKTFITKANASAIPGKTILENSVKHSKALNTLSSPGQSSFSHGTRNNSAKENMEKEKPVKRKMKSSVLPKASTLSKSSA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.