missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PHOX2A (aa 247-284) Control Fragment Recombinant Protein

Product Code. 30209992
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209992 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209992 Supplier Invitrogen™ Supplier No. RP107444

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66785 (PA5-66785, PA5-85047 (PA5-85047. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PHOX2A and PHOX2B (Paired mesoderm homeobox protein) are closely related, paired-homeodomain transcription factors that function as determinants of the noradrenergic phenotype during embryogenesis. PHOX2 proteins are crucial for the regulation of endogenous hydroxylases in neural crest cells and promote sympathetic neuron generation. Human PHOX2B contains one DNA binding homeobox domain and is required for the differentiation of all central and nonperipheral noradrenergic centers in the brain. In contrast, PHOX2A controls only the differentiation of the main noradrenergic center of the brain. Regulation of PHOX2 may have therapeutic utility in aging or disorders involving degeneration of noradrenergic neurons.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O14813
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 401
Name Human PHOX2A (aa 247-284) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias aristaless homeobox gene homolog; aristaless homeobox homolog; aristaless homeobox protein homolog; ARIX; arix homeodomain protein; ARI x 1 homeodomain protein; CFEOM2; FEOM2; NCAM2; paired like homeobox 2 A; paired mesoderm homeobox 2 A; paired mesoderm homeobox protein 2 A; Paired-like homeobox 2 A; Pho x 2; PHO x 2 A; PHO x 2 A homeodomain protein; Pm x 2; Pm x 2 A
Common Name PHOX2A
Gene Symbol PHOX2A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.