missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199938

Invitrogen™ Human PHYH (aa 30-165) Control Fragment Recombinant Protein

Product Code. 30199938
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199938

Brand: Invitrogen™ RP89686

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82436 (PA5-82436. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PHYH2 catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O14832
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5264
Name Human PHYH (aa 30-165) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1600020H07Rik; 2-HPCL; AI256161; AI265699; HPCL; HPCL2; induced by chronic shear stress; LN1; Lnap1; LOC100056651; Lupus nephritis-associated peptide 1; OTTHUMP00000019131; OTTHUMP00000019132; OTTHUMP00000179083; OTTHUMP00000216226; Pahx; PHYH; PHYH protein; PHYH1; PHYH2; phytanic acid oxidase; phytanoil-CoA alpha hydroxylase; phytanoyl-CoA 2 oxoglutarate dioxygenase; phytanoyl-CoA 2-hydroxylase; phytanoyl-CoA alpha-hydroxylase; phytanoyl-CoA dioxygenase peroxisomal; phytanoyl-CoA dioxygenase, peroxisomal; phytanoyl-CoA hydroxylase; phytanoyl-CoA hydroxylase (Refsum disease); RD; zgc:110203
Common Name PHYH
Gene Symbol Phyh
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.