missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200112

Invitrogen™ Human POLR2H (aa 77-150) Control Fragment Recombinant Protein

Product Code. 30200112
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200112

Brand: Invitrogen™ RP105027

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eukaryotes produce 3 distinct classes of RNA polymerase, Pol I, II and III. Each polymerase is responsible for the synthesis of a different class of RNA. RNA polymerase I (Pol I) transcribes the rRNA (ribosomal RNA) genes for the precursor of the 28S, 18S, and 5. 8S molecules of the ribosome. RNA polymerase II transcribes protein-encoding genes into mRNA (messenger RNA) and snRNA (small nuclear RNA) genes into snRNAs that influence the processing of other classes of RNA. RNA polymerase III (Pol III) transcribes the 5S rRNA genes and all of the tRNA (transfer RNA) genes. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. The RPB6 and RPB8 subunits are shared by all 3 RNA polymerases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P52434
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5437
Name Human POLR2H (aa 77-150) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ABC3; DNA-directed RNA polymerase II subunit H; DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide; DNA-directed RNA polymerases I, II, and III subunit RPABC3; hRPB8; hsRPB8; POLR2H; polymerase (RNA) II (DNA directed) polypeptide H; polymerase (RNA) II subunit H; RGD1561203; RNA polymerase II subunit H; RNA polymerases I, II, and III subunit ABC3; RPABC3; RPB17; RPB8; RPB8 homolog
Common Name POLR2H
Gene Symbol POLR2H
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.