missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200322

Invitrogen™ Human PU.1 (aa 18-136) Control Fragment Recombinant Protein

Product Code. 30200322
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200322

Brand: Invitrogen™ RP100692

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83731 (PA5-83731. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P17947
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6688
Name Human PU0.1 (aa 18-136) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 31 kDa transforming protein; 31 kDa-transforming protein; 31 kDa Transforming Protein; Dis1; Dis-1; hCG_25181; hematopoietic transcription factor PU0.1; OF; Pu0.1; SFFV proviral integration 1; SFFV proviral integration 1 protein; Sfpi1; Sfpi-1; Spi1; SPI-1; Spi-1 proto-oncogene; SPIA; SPI-A; spleen focus forming virus (SFFV) proviral integration oncogene; spleen focus forming virus (SFFV) proviral integration oncogene spi1; spleen focus forming virus proviral integration oncogene spi1; Tcfpu1; Tfpu0.1; Transcription factor PU0.1; Transcription Factor spi1
Common Name PU0.1
Gene Symbol SPI1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.