missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207813

Invitrogen™ Human RANBP2 (aa 2145-2181) Control Fragment Recombinant Protein

Product Code. 30207813
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207813

Brand: Invitrogen™ RP105651

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RanBP2 interacts with the small GTP-binding protein Ran and forms a large multiprotein complex involved in many biological processes such as mRNA processing, nuclear transport, cell cycle control and postmitotic nuclear reassembly. The protein is identified by western blotting as an apparent molecular mass of 360 kD. It is involved in nucleation of microtubule and control of cell growth by interacting with many protein factors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49792
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5903
Name Human RANBP2 (aa 2145-2181) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 358 kDa nucleoporin; A430087B05Rik; acute necrotizing encephalopathy 1 (autosomal dominant); ADANE; AI256741; ANE1; E3 SUMO-protein ligase RanBP2; E3 SUMO-protein transferase RanBP2; IIAE3; Nuclear pore complex protein Nup358; nucleoporin 358; nucleoporin Nup358; NUP358; P270; RAN binding protein 2; ran-binding protein 2; RANBP2; RBP2; retina-specific cyclophilin; RGD1560047; spliced variant with Ran-binding and cyclophilin domains; transformation-related protein 2; TRP1; TRP2
Common Name RANBP2
Gene Symbol RANBP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.