missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201219

Invitrogen™ Human RBM5 (aa 343-472) Control Fragment Recombinant Protein

Product Code. 30201219
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201219

Brand: Invitrogen™ RP89627

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53586 (PA5-53586. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEF-3 and LUCA15 belong to an evolutionarily conserved family of RNA binding proteins and share similar expression patterns. Both DEF-3 and LUCA15 are highly expressed in adult heart and thymus as well as fetal kidney. Conversely, fetal thymus and adult kidney express very little DEF-3 and LUCA15. In the haemopoietic system of mice, the expression of DEF-3 is downregulated upon differentiation of progenitor cells into granulocytes but persists during macrophage development. Both DEF-3 and LUCA15 contain two zinc finger motifs, a bipartite nuclear signal and two RNA binding motifs. DEF-3 and LUCA15 are capable of specifically binding poly(G) RNA.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number P52756
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10181
Name Human RBM5 (aa 343-472) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D030069N10Rik; G15; H37; LUCA15; Protein G15; Putative tumor suppressor LUCA15; Rbm5; Renal carcinoma antigen NY-REN-9; RMB5; RNA binding motif protein 5; RNA-binding motif protein 5; RNA-binding protein 5
Common Name RBM5
Gene Symbol RBM5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WSSTQSQSGEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt