missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RC3H2 (aa 1109-1189) Control Fragment Recombinant Protein

Product Code. 30209525
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209525 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209525 Supplier Invitrogen™ Supplier No. RP108466

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84534 (PA5-84534. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RC3H2 gene ontology annotations related to this gene include B cell homeostasis; limb development; lung alveolus development; lymph node development; multicellular organism growth; negative regulation of T-helper 17 cell differentiation; positive regulation of NIK/NF-kappaB signaling; post-embryonic development; posttranscriptional regulation of gene expression; regulation of miRNA metabolic process; spleen development; T cell homeostasis; T cell proliferation; T cell receptor signaling pathway; T follicular helper cell differentiation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9HBD1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54542
Name Human RC3H2 (aa 1109-1189) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FLJ20301; FLJ20713; membrane associated DNA binding protein; membrane-associated nucleic acid binding protein; membrane-associated nucleic acid-binding protein; MNAB; RC3H2; ring finger and CCCH-type domains 2; ring finger and CCCH-type zinc finger domain-containing protein 2; ring finger and CCCH-type zinc finger domains 2; RING finger protein 164; RING-type E3 ubiquitin transferase Roquin-2; RNF164; Roquin-2
Common Name RC3H2
Gene Symbol RC3H2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.