missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200142

Invitrogen™ Human RHBDD2 (aa 290-362) Control Fragment Recombinant Protein

Product Code. 30200142
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200142

Brand: Invitrogen™ RP100183

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111211 (PA5-111211. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Rhomboid family of proteins is made up of several widely conserved polytopic membrane serine proteases that play roles in growth and development. Little is known about the role of RHBDD2. Its overexpression in breast carcinoma appears to be an indicator of poor prognosis and may play a role in breast cancer progression. The related proteins RHBDD1 and RHBDD3 are both involved in the regulation of apoptosis, suggesting that RHBDD2 may also be involved in the modulation of apoptotic activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6NTF9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57414
Name Human RHBDD2 (aa 290-362) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610011L13Rik; AI480532; H_RG122E10.2 A; H_RG122E10.2 b; NPD007; Rhbdd2; Rhbdl7; rhomboid domain containing 2; rhomboid domain-containing protein 2; rhomboid, veinlet-like 7; rhomboid-like protein 7; upregulated during skeletal muscle growth 1; Usmg1; WUGSC:H_RG122E10.2 A; WUGSC:H_RG122E10.2 b
Common Name RHBDD2
Gene Symbol RHBDD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.