missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199210

Invitrogen™ Human RRP9 (aa 253-358) Control Fragment Recombinant Protein

Product Code. 30199210
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30199210 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30199210 Supplier Invitrogen™ Supplier No. RP92413

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58545 (PA5-58545. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Ku autoantigen is a heterodimer of 70kDa (p70) and approximately 80kDa (p80) proteins. The p70/p80 dimer is important for function of a 460kDa DNA-dependent protein kinase that phosphorylates certain transcription factors, including Sp1, Oct-1, p53, and SV40 large T antigen in vitro. Ku protein plays a role in cell signaling, proliferation, DNA repair, replication, transcriptional activation, and apoptosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43818
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9136
Name Human RRP9 (aa 253-358) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 55 kDa; D19435; D9Wsu10e; ribosomal RNA processing 9, small subunit (SSU) processome component, homolog; ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast); ribosomal RNA processing 9, U3 small nucleolar RNA binding protein; RNA, U3 small nucleolar interacting protein 2; RNU3IP2; Rrp9; RRP9 homolog; RRP9, small subunit (SSU) processome component, homolog; RRP9, small subunit (SSU) processome component, homolog (yeast); U3 small nucleolar ribonucleoprotein-associated 55 kDa protein; U3 small nucleolar RNA-interacting protein 2; U3 snoRNP-associated 55 kDa protein; U3 snoRNP-associated 55-kDa protein; U3 snoRNP-associated protein; U355K; U3-55 k
Common Name RRP9
Gene Symbol RRP9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence THQLYSTSHDRSVKVWNVAENSYVETLFGHQDAVAALDALSRECCVTAGGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.