missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201147

Invitrogen™ Human SCIMP (aa 47-141) Control Fragment Recombinant Protein

Product Code. 30201147
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201147

Brand: Invitrogen™ RP88833

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52254 (PA5-52254. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SCIMP (SLP adaptor and Csk interacting membrane protein), also known as Nvl, is a palmitoylated transmembrane adaptor protein expressed in professional antigen presenting cells, most prominently in the lymph nodes and spleen. It is associated with tetraspanin-enriched microdomains (together with MHC II). There is a close relationship between SCIMP and tyrosinkinase Lyn, which is constitutively bound to it by its SH3 domain. After MHC II-mediated stimulation in the immunological synapse SCIMP becomes phosphorylated at several tyrosine residues and provides docking sites for Grb2 and SLP65 or SLP76 adaptors transducing the signal downstream, as well as for the kinase Csk with modulatory roles.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6UWF3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 388325
Name Human SCIMP (aa 47-141) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A430084P05Rik; C17orf87; DTFT5783; SCIMP; SLP adapter and CSK-interacting membrane protein; SLP adaptor and CSK interacting membrane protein; SLP65/SLP76, Csk-interacting membrane protein; transmembrane protein C17orf87; transmembrane protein C17orf87 homolog; UNQ5783; UNQ5783/PRO16090
Common Name SCIMP
Gene Symbol SCIMP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRGKKWEIAKPLKHKQVDEEKMYENVLNESPVQLPPLPPRNWPSLEDSSPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDDYDDVEIPANTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.