missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200926

Invitrogen™ Human SGCB (aa 241-318) Control Fragment Recombinant Protein

Product Code. 30200926
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200926

Brand: Invitrogen™ RP90379

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52835 (PA5-52835. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16585
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6443
Name Human SGCB (aa 241-318) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 43 kDa dystrophin-associated glycoprotein; 43 DAG; 43 kDa; A3b; AI747103; AI844814; beta sarcoglycan; beta-sarcoglycan; beta-sarcoglycan(43 kD dystrophin-associated glycoprotein); beta-SG; fa03a05; LGMD2E; limb girdle muscular dystrophy 2 E (non-linked families); sarcoglycan beta; sarcoglycan, beta (43 kD dystrophin-associated glycoprotein); sarcoglycan, beta (43 kDa dystrophin-associated glycoprotein); sarcoglycan, beta (dystrophin-associated glycoprotein); SGC; Sgcb; wu:fa03a05; zgc:110833
Common Name SGCB
Gene Symbol SGCB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt