missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199175

Invitrogen™ Human SLC51B (aa 77-127) Control Fragment Recombinant Protein

Product Code. 30199175
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199175

Brand: Invitrogen™ RP88590

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52574 (PA5-52574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The heteromeric transporter OST Alpha/OST Beta facilitates the transport of bile and other steroid solutes across the basolateral epithelial cell membrane of intestine, liver, testis, kidney and adrenal gland. OST Alpha/OST Beta expression is induced by bile acids through ligand-dependent transactivation of their genes by FXR (Farnesoid X-activated receptor). This genetic regulation suggests that in response to changes in intracellular bile acid levels, bile acids adjust the rate of their own efflux from enterocytes. OST Beta is a 128 amino acid single-pass transmembrane protein that requires OST Alpha to localize to the plasma membrane. Coexpression of OST Alpha and OST Beta is also required to convert the OST Alpha subunit to a mature glycosylated endoglycosidase H-resistant form, suggesting that co-expression facilitates trafficking of OST Alpha through the golgi apparatus. Though widely expressed, OST Beta is present at highest levels in ileum.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86UW2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 123264
Name Human SLC51B (aa 77-127) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias organic solute transporter beta; organic solute transporter beta subunit; organic solute transporter subunit beta; Ost beta; Ostb; Ostbeta; OST-beta; RGD1565748; Slc51b; solute carrier family 51 beta subunit; solute carrier family 51 subunit beta; solute carrier family 51, beta subunit
Common Name SLC51B
Gene Symbol SLC51B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.