missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200858

Invitrogen™ Human SND1 (aa 484-588) Control Fragment Recombinant Protein

Product Code. 30200858
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200858

Brand: Invitrogen™ RP102051

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82020 (PA5-82020. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SND1/P100 (staphylococcal nuclease and tudor domain containing 1), also known as TudorSN, functions in the Pim-1 regulation of Myb activity and acts as a transcriptional activator of EBNA-2. It also interacts with EAV, NSP1, GTF2E1 and GTF2E2, and forms a ternary complex with Stat6 and POLR2A. The staphylococcal nuclease-like (SN)-domains directly interact with amino acids 1099-1758 of CBP. SND1/P100 plays an important role in the assembly of Stat6 transcriptome and stimulates IL-4-dependent transcription by mediating interaction between Stat6 and CBP.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7KZF4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27044
Name Human SND1 (aa 484-588) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 100 kDa coactivator; 4 SNc-Tudor domain protein; 4 SNc-Tudor domain protein long form; 4 SNc-Tudor domain protein short form; AL033314; EBNA-2 co-activator (100 kD); EBNA2 coactivator p100; p100; p100 co-activator; p100 co-activator variant 1; p100 EBNA2 co-activator; p100L; P100-like protein short variant; p100S; similar to Homo sapiens EBNA-2 co-activator (100 kDa coactivator); p105 coactivator; SN4TDR; SND p102; SND1; snd1 protein; SND1-BRAF fusion; staphylococcal nuclease and tudor domain containing 1; staphylococcal nuclease domain containing 1; staphylococcal nuclease domain-containing protein 1; TDRD11; testis tissue sperm-binding protein Li 82 P; tudor domain-containing protein 11; TudorSN; Tudor-SN; wu:fc27g10
Common Name SND1
Gene Symbol Snd1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.