missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SNX29 (aa 491-573) Control Fragment Recombinant Protein

Product Code. 30199592
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199592

Brand: Invitrogen™ RP109028

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140039 (PA5-140039. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNX29 also known as RUNDC2A, is a 375 amino protein that contains one RUN domain. RUNDC2A is encoded by a gene that maps to human chromosome 16p13.13, which encodes over 900 genes and comprises nearly 3% of the human genome. The GAN gene is located on chromosome 16 and, with mutation, may lead to giant axonal neuropathy, a nervous system disorder characterized by increasing malfunction with growth. The rare disorder Rubinstein-Taybi syndrome is also associated with chromosome 16, as is Crohn's disease, which is a gastrointestinal inflammatory condition.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TEQ0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 92017
Name Human SNX29 (aa 491-573) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933437K13Rik; A-388D4.1; ENSMUSG00000079738; Gm11170; Gm1737; Gm930; RUN domain containing 2 A; RUN domain-containing protein 2 A; RUNDC2A; SN x 29; SODD; sorting nexin 29; sorting nexin-29
Common Name SNX29
Gene Symbol SNX29
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LRNLLDGEMEHSAALRQEVDTLKRKVAEQEERQGMKVQALARENEVLKVQLKKYVGAVQMLKREGQTAEVPNLWSVDGEVTVA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.