missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199030

Invitrogen™ Human SPRY1 (aa 65-141) Control Fragment Recombinant Protein

Product Code. 30199030
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30199030 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30199030 Supplier Invitrogen™ Supplier No. RP103096

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62392 (PA5-62392. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sprouty-1 and -2 are membrane-anchored phosphoprotein inhibitors of growth factor signaling in endothelial cells. Four mammalian Sprouty homologues (Sprouty-1-4) have been identified. One study showed that overexpressed Sprouty-1 and -2 inhibits fibroblast growth factor and vascular endothelial growth factor-induced proliferation and differentiation by repressing pathways leading to MAP kinase activation. Sprouty proteins are also endogenous inhibitors of the Ras/MAP kinase pathway that play an important role in the remodeling of branching tissues, such as in development of the lung, kidney tubules, vascular system, and breast ducts. A recent study shows that Sprouty-1 and -2 may have tumor suppressing activity in the breast, and found that both proteins are consistently down-regulated in breast carcinomas.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43609
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10252
Name Human SPRY1 (aa 65-141) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias hSPRY1; Protein sprouty homolog 1; sprouty 1; sprouty homolog 1 (Drosophila); sprouty homolog 1, antagonist of FGF signaling; sprouty homolog 1, antagonist of FGF signaling (Drosophila); sprouty RTK signaling antagonist 1; sprouty, Drosophila, homolog of, 1 (antagonist of FGF signaling); sprouty1; SPRY1; spry-1
Common Name SPRY1
Gene Symbol SPRY1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.