missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199717

Invitrogen™ Human Staufen (aa 487-575) Control Fragment Recombinant Protein

Product Code. 30199717
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199717

Brand: Invitrogen™ RP103061

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83984 (PA5-83984. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STAU1 is a member of a family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human STAU1 also contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. STAU1 has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER. STAU1 is also known to interact with influenza ribonucleoproteins NS1, NP, and PA and is required for efficient viral replication.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95793
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6780
Name Human Staufen (aa 487-575) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5830401L18Rik; AW549911; C85792; Double-stranded RNA-binding protein Staufen homolog 1; PPP1R150; protein phosphatase 1, regulatory subunit 150; RP3-470L14.2; STAU; Stau1; staufen (RNA binding protein) homolog 1 (Drosophila); staufen double-stranded RNA binding protein 1; staufen RNA binding protein homolog 1; staufen, RNA binding protein, homolog 1
Common Name Staufen
Gene Symbol Stau1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.