missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198954

Invitrogen™ Human TAF1D (aa 175-255) Control Fragment Recombinant Protein

Product Code. 30198954
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198954

Brand: Invitrogen™ RP101444

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63212 (PA5-63212. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAF1D is a member of the SL1 complex, which includes TBP (MIM 600075) and TAF1A (MIM 604903), TAF1B (MIM 604904), and TAF1C (MIM 604905), and plays a role in RNA polymerase I transcription.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H5J8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79101
Name Human TAF1D (aa 175-255) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810003M17Rik; 4930553M18Rik; 5930426I11Rik; JOSD3; Josephin domain containing 3; RAFI41; RNA polymerase I-specific TBP-associated factor 41 kDa; TAF(I)41; TAF1D; TAFI41; TATA box binding protein (Tbp)-associated factor, RNA polymerase I, D; TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41 kDa; TATA box binding protein associated factor 1 D; TATA box binding protein-associated factor, RNA polymerase I, D; TATA box-binding protein-associated factor 1 D; TATA box-binding protein-associated factor RNA polymerase I subunit D; TATA-box binding protein associated factor, RNA polymerase I subunit D; TATA-box binding protein associated factor, RNA polymerase I, D; TBP-associated factor 1 D; Transcription initiation factor SL1/TIF-IB subunit D
Common Name TAF1D
Gene Symbol TAF1D
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEESTAEDEDATHLEDNECDIKLAGDSFIVSSEFPVRLSVYLEEEDIT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.