missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human TCIRG1 Partial ORF (NP_006010.2, 138 a.a. - 235 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human TCIRG1 Partial ORF (NP_006010.2, 138 a.a. - 235 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16142336
Change view
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16142336 25 μg 25µg
16132336 10 μg 10µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 16142336 Supplier Abnova™ Supplier No. H00010312Q02.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis. [provided by RefSeq]

Sequence: PQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKI

Specifications

Accession Number NP_006010.2
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 10312
Molecular Weight (g/mol) 36.52kDa
Name TCIRG1 (Human) Recombinant Protein (Q02)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 μg
Immunogen PQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKI
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias ATP6N1C/ATP6V0A3/Atp6i/OC-116kDa/OC116/OPTB1/Stv1/TIRC7/Vph1/a3
Common Name TCIRG1
Gene Symbol TCIRG1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.