missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199672

Invitrogen™ Human TGIF2 (aa 112-180) Control Fragment Recombinant Protein

Product Code. 30199672
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199672

Brand: Invitrogen™ RP106494

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111379 (PA5-111379. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor, which appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and over-expressed in some ovarian cancers. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. Read-through transcription also exists between this gene and the neighboring downstream C20orf24 gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9GZN2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 60436
Name Human TGIF2 (aa 112-180) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4921501K24; 5730599O09Rik; 5'-TG-3' interacting factor 2; 5'-TG-3'-interacting factor 2; C80753; C81206; Homeobox protein TGIF2; OTTHUMP00000030849; RGD1560115; RGD1564927; TALE family homeobox; TGF(beta)-induced transcription factor 2; TGFB induced factor homeobox 2; TGF-beta-induced transcription factor 2; TGFB-induced factor 2; TGFB-induced factor 2 (TALE family homeobox); TGFB-induced factor homeobox 2; TGFB-induced factor homeobox 2-like 1; TGIF2; Tgif2l1; transcription growth factor-beta-induced factor 2
Common Name TGIF2
Gene Symbol TGIF2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.