missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200941

Invitrogen™ Human TLR7 (aa 588-680) Control Fragment Recombinant Protein

Product Code. 30200941
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200941

Brand: Invitrogen™ RP101590

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111492 (PA5-111492. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TLR7 is a 10 amino acid long highly conserved membrane protein belonging to the Toll-like receptor (TLR) family with 27 LRR (leucine-rich) repeats and a TIR domain. TLR7 plays a fundamental role in pathogen recognition and activation of innate immunity. TLR7 is activated by infections with single-stranded RNA viruses, including influenza virus and vesicular stomatitis virus (VSV). TLR7 is predominantly expressed in lung, placenta, and spleen, and lies in close proximity to another family member, TLR8. TLR7 also acts via MyD88 and TRAF6, leading to NF-kappaB activation, cytokine secretion and the inflammatory response. TLR7 recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NYK1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51284
Name Human TLR7 (aa 588-680) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias RGD1563357; RP23-139P21.3; Tlr7; TLR7-like; toll like receptor 7; toll-like receptor 7; toll-like receptor 7-like; UNQ248/PRO285
Common Name TLR7
Gene Symbol TLR7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.