missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205304

Invitrogen™ Human TSC22D1 (aa 628-712) Control Fragment Recombinant Protein

Product Code. 30205304
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205304

Brand: Invitrogen™ RP108113

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67456 (PA5-67456. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSC22 domain family protein, or TSC22, is a transcription factor that belongs to the large family of early response genes. This transcriptional repressor is known to act on the C-type natriuretic peptide (CNP) promoter. TSC22 belongs to the TSC-22/Dip/Bun family and is an intracellular protein that may be found in the cytoplasm or nucleus. This transcription factor is known to regulate cell growth, differentiation and cell death and is involved in modulating the transcriptional activity of Smad3 and Smad4. This protein is ubiquitously expressed in most tissues and widely in both fetal and adult tissues. It is generally expressed in aortic endothelial cells, and induced by cytokines, including TGFB. These proteins may be possible therapeutic targets of leukemia and prostate cancer.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15714
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8848
Name Human TSC22D1 (aa 628-712) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA589566; AW105905; Cerebral protein 2; Egr5; hucep-2; Kiaa1994; Ptg-2; regulatory protein Tsc22; Regulatory protein TSC-22; RP11-269C23.2; short tandem repeat locus PEZ20 variant 19; Tgfb1i4; TGFbeta-stimulated clone 22; Tgfb-stimulated clone 22 homolog; Tilz1b; transcriptional regulator TSC-22; transforming growth factor beta 1 induced transcript 4; Transforming growth factor beta stimulated clone 22; transforming growth factor beta-1-induced transcript 4 protein; transforming growth factor beta-stimulated protein TSC-22; TS22A; Tsc; Tsc22; TSC-22; TSC22 domain family member 1; TSC22 domain family protein 1; TSC22 domain family, member 1; TSC22D1; Tsc22-related inducible leucine zipper 1 b
Common Name TSC22D1
Gene Symbol Tsc22d1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.