missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TSPAN9 (aa 123-200) Control Fragment Recombinant Protein

Product Code. 30209932
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209932

Brand: Invitrogen™ RP90695

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53110 (PA5-53110. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TSPAN9 includes the tetraspan family protein members which are characterized by four predicted transmembrane domains, and are thought to be involved in physiological processes such as tissue differentiation, immunological responses, and sperm-egg fusion. TSPAN9 has recently been identified as a platelet tetraspanin and a component of tetraspanin microdomains that include the collagen receptor GPVI (glycoprotein VI) and integrin alpha6beta1 but not the von Willebrand receptor GPIbalpha or the integrins alphaIIbbeta3 or alpha2beta1, suggesting that TSPAN9 may act to regulate platelet function in concert with other tetraspanins and their associated proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75954
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10867
Name Human TSPAN9 (aa 123-200) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6720474K14Rik; 9430079M16Rik; AU018597; NET5; NET-5; new EST tetraspan 5; PP1057; RGD1304740; tetraspan NET-5; tetraspanin 9; tetraspanin-9; transmembrane 4 superfamily member tetraspan NET-5; Tspan9; tspan-9
Common Name TSPAN9
Gene Symbol TSPAN9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLLYHTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.