missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209655

Invitrogen™ Human ZBTB4 (aa 795-872) Control Fragment Recombinant Protein

Product Code. 30209655
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209655

Brand: Invitrogen™ RP103705

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64181 (PA5-64181. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ZBTB family of proteins is comprised of diverse zinc finger proteins that also contain a BTB (BR-C, ttk and bab) domain. Similar to Kaiso, a zinc-finger containing protein that can bind methylated CpGs, ZBTB4 can also bind methylated DNA and repress transcription. ZBTB4 has been shown to associate with the Sin3/histone deacetylase co-repressor and repress expression of P21CIP1 as part of a heterodimeric complex with Miz1. In cultured cells, depletion of ZBTB4 promotes cell cycle arrest in response to p53 activation and suppresses apoptosis through regulation of P21CIP1, suggesting that ZBTB4 is a critical determinant of the cellular response to p53 activation. HIPK2, a kinase that is involved in cellular proliferation and survival, phosphorylates and down-regulates ZBTB4 under normal cell growth conditions; this degradation increases with DNA damage.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9P1Z0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57659
Name Human ZBTB4 (aa 795-872) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310026P19Rik; 9230111I22Rik; KAISO-L1; KAISO-like zinc finger protein 1; Kiaa1538; mKIAA1538; Zbtb4; zinc finger and BTB domain containing 4; zinc finger and BTB domain-containing protein 4; ZNF903
Common Name ZBTB4
Gene Symbol ZBTB4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEEASETASLQDPIISGGEEPPVVASGGSYVYPPV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.