missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZC3H13 (aa 1525-1639) Control Fragment Recombinant Protein

Product Code. 30180957
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180957

Brand: Invitrogen™ RP97943

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58744 (PA5-58744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The zinc finger CCCH domain-containing protein 13 (ZC3H13) is a 1668 amino acid protein that contains one C3H1-type zinc finger. ZC3H13 is phosphorylated upon DNA damage, most likely by ATM or ATR. Two isoforms of ZC3H13 exists as a result of alternative splicing events. The gene encoding ZC3H13 maps to chromosome 13, which contains around 114 million base pairs and 400 genes. Key tumor suppressor genes on chromosome 13 include the breast cancer susceptibility gene, BRCA2, and the RB1 (retinoblastoma) gene. As with most chromosomes, polysomy of part or all of chromosome 13 is deleterious to development and decreases the odds of survival. Trisomy 13, also known as Patau syndrome, is quite deadly and the few who survive past one year suffer from permanent neurologic defects, difficulty eating and vulnerability to serious respiratory infections.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5T200
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23091
Name Human ZC3H13 (aa 1525-1639) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2600010B19Rik; 3110050K21Rik; 4930570G11Rik; C87618; KIAA0853; RGD1307729; ZC3H13; Zinc finger CCCH domain-containing protein 13; zinc finger CCCH type containing 13; zinc finger CCCH-type containing 13
Common Name ZC3H13
Gene Symbol ZC3H13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AVMLRVGISKKLAGSELFAKVKETCQRLLEKPKDADNLFEHELGALNMAALLRKEERASLLSNLGPCCKALCFRRDSAIRKQLVKNEKGTIKQAYTSAPMVDNELLRLSLRLFKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.