missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199896

Invitrogen™ Human ZGPAT (aa 304-388) Control Fragment Recombinant Protein

Product Code. 30199896
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199896

Brand: Invitrogen™ RP105049

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66034 (PA5-66034. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene involved in cell proliferation, survival and migration. Its ability to repress genes of the EGFR pathway suggest it may act as a tumor suppressor. Able to suppress breast carcinogenesis. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N5A5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84619
Name Human ZGPAT (aa 304-388) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500006I01Rik; BC021513; G patch domain-containing protein 6; GPATC6; GPATCH6; KIAA1847; RGD1310801; ZC3H9; ZC3HDC9; ZGPAT; Zinc finger and G patch domain-containing protein; zinc finger CCCH domain-containing protein 9; zinc finger CCCH-type and G-patch domain containing; zinc finger CCCH-type with G patch domain; zinc finger CCCH-type with G patch domain-containing protein; zinc finger, CCCH-type with G patch domain; zinc finger, CCCH-type with G patch domain isoform c; zinc finger, CCCH-type with G-patch domain; ZIP
Common Name ZGPAT
Gene Symbol ZGPAT
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.