missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199480

Invitrogen™ Human ZHX2 (aa 655-794) Control Fragment Recombinant Protein

Product Code. 30199480
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30199480 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30199480 Supplier Invitrogen™ Supplier No. RP89410

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52373 (PA5-52373. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-fingers and homeobox (ZHX) proteins are transcription factors that interact with the activation domain of the A subunit of nuclear factor-Y (NF-YA). ZHX1-3 are ubiquitously expressed proteins expressed in various tissues. They act as transcriptional repressors and localize to the nucleus. The ZHX proteins contain two Cys(2)-His(2)-type zinc-finger motifs and five homeodomains (HDs). These domains allow the ZHX proteins to form homodimers, but they can also form heterodimers with each other. However, this dimerization is not required for repressor activity. Hypermethylation-mediated silencing of ZHX2 is an epigenetic event involved in hepatocellular carcinoma (HCC).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y6X8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22882
Name Human ZHX2 (aa 655-794) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AFP regulator 1; AFR1; Afr-1; alpha fetoprotein regulation 1, adult; alpha-fetoprotein regulator 1; KIAA0854; LOW QUALITY PROTEIN: zinc fingers and homeoboxes protein 2; mKIAA0854; Raf; Regulator of AFP; transcription factor ZHX2; Zhx2; Zinc finger and homeodomain protein 2; zinc fingers and homeoboxes 2; zinc fingers and homeoboxes protein 2; zinc-fingers and homeoboxes 2
Common Name ZHX2
Gene Symbol ZHX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEESSVVDYV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.