missing translation for 'onlineSavingsMsg'
Learn More

preproANP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

359.00 € - 515.00 €

Specifications

Antigen	preproANP
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18419771 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-34105-25ul	25 μL	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A View alternative products Save Up to »

18143903 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-34105	0.1 mL	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A View alternative products Save Up to »

Description

preproANP Polyclonal antibody specifically detects preproANP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antigen	preproANP
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	ANF, ANP, ATFB6, atrial natriuretic factor prohormone, atrial natriuretic peptide prohormone, ATRST2, CDD, CDD-ANF, CDP, natriuretic peptides A, PND
Gene Symbols	NPPA
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	P01160
Gene ID (Entrez)	4878
Immunogen	This antibody was developed against recombinant preproANP protein corresponding to amino acids: GQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWT
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

preproANP Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents