missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RASSF2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
198.00 € - 468.00 €
Specifications
| Antigen | RASSF2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RASSF2 Polyclonal antibody specifically detects RASSF2 in Human samples. It is validated for Western BlotSpecifications
| RASSF2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 9770 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| KIAA0168DKFZp781O1747, Ras association (RalGDS/AF-6) domain family 2, Ras association (RalGDS/AF-6) domain family member 2, ras association domain-containing protein 2, RASFADIN | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 70-160 of human RASSF2 (NP_055552.1). MQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title