missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HPV HPV 18 Protein

Name: enQuireBio&trade; Recombinant HPV HPV 18 Protein
Brand: enQuireBio&trade;
SKU: 15940009
Price: 870.00 EUR

A cDNA sequence encoding the HPV 18 was constructed and used to recombinantly synthesize the protein.

Brand: enQuireBio™ QP12308-500ug

Additional Details : Weight : 0.01000kg

Product Code. 15940009

Estimated Shipment: 07-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Specifications

Name	HPV HPV 18 Protein
Regulatory Status	Research Use Only
Product Type	Recombinant Protein
Species	E. coli
Sequence	VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA
Purity or Quality Grade	Protein is >90% pure as determined by 10% PAGE (Coomassie staining).

Quantity	500 μg
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Cross Reactivity	HPV
Protein Tag	GST
Buffer	Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.

Product Suggestions

Description