missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HPV HPV 18 Protein

A cDNA sequence encoding the HPV 18 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12308-1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15930009

  • 1600.00 € / 1mg
Estimated Shipment: 13-01-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

HPV HPV 18 Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HPV
GST
Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Research Use Only
Recombinant Protein
E. coli
VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA
Videos
SDS
Documents
Certificates
Special Offers

Special Offers