missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant HSV HSV-2 gB Protein
A cDNA sequence encoding the HSV-2 gB was constructed and used to recombinantly synthesize the protein.
228.00 € - 1740.00 €
Specifications
Name | HSV HSV-2 gB Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | HSV |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15930119
|
enQuireBio™
QP12342-100UG |
100 μg |
228.00 €
100µg |
Estimated Shipment: 30-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15950119
|
enQuireBio™
QP12342-500UG |
500 μg |
870.00 €
500µg |
Estimated Shipment: 30-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15940119
|
enQuireBio™
QP12342-1MG |
1 mg |
1740.00 €
1mg |
Estimated Shipment: 30-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
HSV HSV-2 gB Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
HSV | |
His | |
10mM Phosphate buffer pH 7.6 and 75mM NaCl. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH | |
Protein is >90% pure as determined by SDS PAGE. |