missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HSV HSV-2 gB Protein

A cDNA sequence encoding the HSV-2 gB was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12342-100ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15930119

  • 205.00 € / 100µg
Estimated Shipment: 20-01-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

HSV HSV-2 gB Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HSV
His
10mM Phosphate buffer pH 7.6 and 75mM NaCl.
Protein is >90% pure as determined by SDS PAGE.
Research Use Only
Recombinant Protein
E. coli
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers