missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human FSH Protein

A cDNA sequence encoding the FSH was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP10620-2ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15934438

  • 120.00 € / 2µg
Estimated Shipment: 23-01-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

FSH Protein
2 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
HEK 293
FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSFSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Greater than 95% as determined by SDS-PAGE.
Research Use Only
The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.
Human
Untagged
The recombinant FSH was lyophilized from a concentrated (1 mg/ml) solution containing PBS.
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers