missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human HGF B Protein
A cDNA sequence encoding the HGF B was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12230-10ug
Additional Details : Weight : 0.01000kg
Specifications
HGF B Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS | |
Greater than 95.0% as determined by SDS-PAGE. |
10 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Human | |
His | |
HGF-B protein is supplied in 25mM Na. Acetate, pH 4.8, 1mM EDTA and 50% glycerol. |