missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human MOG Protein
A cDNA sequence encoding the MOG was constructed and used to recombinantly synthesize the protein.
131.00 € - 2175.00 €
Specifications
Name | MOG Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | Human |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15991319
|
enQuireBio™
QP12718-10UG |
10 μg |
131.00 €
10µg |
Estimated Shipment: 14-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15911329
|
enQuireBio™
QP12718-50UG |
50 μg |
203.00 €
50µg |
Estimated Shipment: 06-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15901329
|
enQuireBio™
QP12718-1MG |
1 mg |
2175.00 €
1mg |
Estimated Shipment: 06-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
MOG Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Human | |
His | |
The Myelin Oligodendrocyte Glycoprotein 0.5 mg/ml solution was lyophilized from 20mM sodium acetate buffer pH 4 and 0.3M sodium chloride. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH | |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |