missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SELE Protein

A cDNA sequence encoding the SELE was constructed and used to recombinantly synthesize the protein.

131.00 € - 2900.00 €

Name	SELE Protein
Regulatory Status	Research Use Only
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type	Recombinant Protein
Cross Reactivity	Human

View More Specs

Products 3

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
15993599 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP13450-2UG	2 μg	131.00 € 2µg View alternative products Save Up to »	Estimated Shipment: 04-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

15973599 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP13450-10UG	10 μg	203.00 € 10µg View alternative products Save Up to »	Estimated Shipment: 04-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

15983599 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP13450-1MG	1 mg	2900.00 € 1mg View alternative products Save Up to »	Estimated Shipment: 04-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Specifications

Name	SELE Protein
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Cross Reactivity	Human
Protein Tag	His
Buffer	SELE was lyophilized from a 0.2 microm filtered solution of PBS and 4% Mannitol, pH 7.5.

Regulatory Status	Research Use Only
Product Type	Recombinant Protein
Species	Human (HEK293)
Sequence	WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH
Purity or Quality Grade	Greater than 95% as determined by SDS-PAGE.

Description