missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. enQuireBio™ Recombinant Mouse Noggin Protein

enQuireBio™ Recombinant Mouse Noggin Protein

Product Code. p-7148605
Click to view available options
Quantity:
1 mg
20 μg
5 μg
Unit Size:
1mg
20µg
5µg
This item is not returnable. View return policy

Product Code. 15915198

Brand: enQuireBio™ QP107955ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

A cDNA sequence encoding the Noggin was constructed and used to recombinantly synthesize the protein.

Specifications

Name Noggin Protein
Quantity 5 μg
Regulatory Status Research Use Only
Endotoxin Concentration < 1.0 EU per ug protein as determined by the LAL method.
Biological Activity The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 M 105 IU/mg in the presence of 5ng/ml BMP-4.
Product Type Recombinant Protein
Cross Reactivity Mouse
Species E. coli
Protein Tag Untagged
Sequence MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC
Buffer Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.
Purity or Quality Grade Greater than 95.0% as determined by SDS-PAGE.
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.