missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rabbit IL 8 Protein
A cDNA sequence encoding the IL 8 was constructed and used to recombinantly synthesize the protein.
131.00 € - 5220.00 €
Specifications
Gene ID (Entrez) | 100009129 |
---|---|
Name | IL 8 Protein |
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Gene Symbol | CXCL8 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15960299
|
enQuireBio™
QP12400-5UG |
5 μg |
131.00 €
5µg |
Estimated Shipment: 21-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15950299
|
enQuireBio™
QP12400-25UG |
25 μg |
203.00 €
25µg |
Estimated Shipment: 21-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15940299
|
enQuireBio™
QP12400-1MG |
1 mg |
5220.00 €
1mg |
Estimated Shipment: 21-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
100009129 | |
Research Use Only | |
CXCL8 | |
Rabbit | |
His | |
The IL-8 solution (1 mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5. |
IL 8 Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Recombinant Protein | |
E. coli | |
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES | |
Greater than 90% as determined by SDS-PAGE. |