missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant West Nile Virus WNV Pre-M Protein
A cDNA sequence encoding the WNV Pre-M was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP13965-100ug
Additional Details : Weight : 0.01000kg
Specifications
West Nile Virus WNV Pre-M Protein | |
100 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
West Nile Virus | |
His | |
20mM phosphate buffer pH 7.5. |
Protein is >95% pure as determined by SDS-PAGE. | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE |