missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant West Nile Virus WNV Pre-M Protein

A cDNA sequence encoding the WNV Pre-M was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13965-100ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15955259

  • 205.00 € / 100µg
Estimated Shipment: 08-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

West Nile Virus WNV Pre-M Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
West Nile Virus
His
20mM phosphate buffer pH 7.5.
Protein is >95% pure as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers