missing translation for 'onlineSavingsMsg'
Learn More
Learn More
S100A8 Antibody (CL11171), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP3-07985-100ul
This item is not returnable.
View return policy
Description
S100A8 Monoclonal antibody specifically detects S100A8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| S100A8 | |
| Monoclonal | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| CL11171 | |
| Immunohistochemistry 1:2000 - 1:5000, Immunohistochemistry-Paraffin 1:2000 - 1:5000 | |
| 60B8AG, CAGACP-10, calgranulin A, calgranulin-A, Calprotectin L1L subunit, CFAGL1Ag, CGLA, Cystic fibrosis antigen, Leukocyte L1 complex light chain, MA387, MIF, Migration inhibitory factor-related protein 8, MRP-8, MRP8S100 calcium binding protein A8 (calgranulin A), NIF, P8, protein S100-A8, S100 calcium binding protein A8, S100 calcium-binding protein A8, S100 calcium-binding protein A8 (calgranulin A), Urinary stone protein band A | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM | |
| 100 μg | |
| Cancer | |
| 6279 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction