missing translation for 'onlineSavingsMsg'
Learn More
Learn More
14-3-3 epsilon Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
353.00 € - 518.00 €
Specifications
| Antigen | 14-3-3 epsilon |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18401392
|
Novus Biologicals
NBP1-89827-25ul |
25 μL |
353.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18271826
|
Novus Biologicals
NBP1-89827 |
0.1 mL |
518.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
14-3-3 epsilon Polyclonal specifically detects 14-3-3 epsilon in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| 14-3-3 epsilon | |
| Polyclonal | |
| Rabbit | |
| Cancer, Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 7531 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| 14-3-3 epsilon, 14-3-3 protein epsilon, FLJ45465, FLJ53559,14-3-3E, KCIP-1, MDCR, MDS, mitochondrial import stimulation factor L subunit, protein kinase C inhibitor protein-1, tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilonpolypeptide | |
| YWHAE | |
| IgG | |
| Affinity Purified | |
| Specificity of human 14-3-3 epsilon antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title