missing translation for 'onlineSavingsMsg'
Learn More
Learn More
14-3-3 zeta Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92614-0.1ml
This item is not returnable.
View return policy
Description
14-3-3 zeta Polyclonal antibody specifically detects 14-3-3 zeta in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| 14-3-3 zeta | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| KCIP-1MGC126532,14-3-3-zeta, MGC111427, MGC138156, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide, zeta polypeptide | |
| A synthetic peptide corresponding to a sequence within amino acids 146-245 of human 14-3-3 zeta (NP_001129171.1). QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN | |
| 0.1 mL | |
| Cell Cycle and Replication | |
| 7534 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction