missing translation for 'onlineSavingsMsg'
Learn More
Learn More
5-HT3B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-90316-25ul
This item is not returnable.
View return policy
Description
5-HT3B Polyclonal specifically detects 5-HT3B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| 5-HT3B | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| 5-HT3-B, 5-HT3B5-hydroxytryptamine receptor 3B, 5-hydroxytryptamine (serotonin) receptor 3B, 5-hydroxytryptamine 3 receptor B subunit, Serotonin receptor 3B, serotonin-gated ion channel subunit | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HTR3B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSR | |
| 25 μL | |
| Signal Transduction | |
| 9177 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction